Pseudomonas sp. Os17: POS17_4815 Help Entry POS17_4815        CDS       T04177                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism psos  Pseudomonas sp. Os17 Brite KEGG Orthology (KO) [BR:psos00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psos03110]     POS17_4815 (groES)    03029 Mitochondrial biogenesis [BR:psos03029]     POS17_4815 (groES) Chaperones and folding catalysts [BR:psos03110]  Heat shock proteins   HSP10    POS17_4815 (groES) Mitochondrial biogenesis [BR:psos03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     POS17_4815 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  BAQ76509 LinkDB All DBs Position complement(5407226..5407519) Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEESKTAGGIVLPGSAAEKPNRGEIVAVGTGRVLDNGEVRALAVK VGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVIEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtcgtcatccgtcgcagcgaagaagaatcgaaa actgccggcggcatcgttctgcctggttcggctgctgaaaaacctaaccgtggcgaaatc gtcgctgtaggtaccggccgtgtgctggacaacggtgaagtacgtgcgctggccgtgaaa gtgggtgacaaagtggtgtttggcccgtactccggcagcaacaccgtgaaagtcgatggc gaagatctgctggtaatggccgagaacgagattctcgctgttatcgaaggctga

DBGET integrated database retrieval system