Pseudomonas sp. Os17: POS17_5913 Help Entry POS17_5913        CDS       T04177                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism psos  Pseudomonas sp. Os17 Brite KEGG Orthology (KO) [BR:psos00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psos03036]     POS17_5913 Chromosome and associated proteins [BR:psos03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     POS17_5913 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB ADIP Motif Other DBs NCBI-ProteinID:  BAQ77607 LinkDB All DBs Position 6587060..6587269 Genome browser AA seq 69 aa AA seqDB search MEDTDLHALMARLELLITRVEQLKSQNALLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcacgcactgatggccagactcgaactgcttattacccgggtc gagcaactaaagagtcaaaacgcactcttattagctcaggaaaagacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system