Prescottella soli: ABI214_00115 Help Entry ABI214_00115      CDS       T10552                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psow  Prescottella soli Pathway psow01100   Metabolic pathways psow01110   Biosynthesis of secondary metabolites Module psow_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:psow00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABI214_00115    00074 Mycolic acid biosynthesis     ABI214_00115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABI214_00115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XBK10847 LinkDB All DBs Position 26547..26810 Genome browser AA seq 87 aa AA seqDB search MVEEVTGIKPSEVTIEKSFVDDLDIDSLSLVDVAVRLEDTHGVKIPDEDMQGLRTVGDAV AYVQKMEAENAELATELKAKVREGRVE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atcgtcgaggaggtgaccggcatcaagccttccgaggtgacgatcgagaagtcgttcgtc gacgacttggacatcgactcgctgtcactggtggacgtcgccgtgcggctcgaggacacg cacggcgtcaagatcccggacgaggatatgcaaggactcaggaccgttggtgacgcagtg gcctacgtccagaagatggaagcggagaacgctgagcttgcgacggagctgaaggcgaag gtcagagagggtcgggtcgagtag

DBGET integrated database retrieval system