Psychrobacter sp. P2G3: AK823_08350 Help Entry AK823_08350       CDS       T04386                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pspg  Psychrobacter sp. P2G3 Brite KEGG Orthology (KO) [BR:pspg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pspg03032]     AK823_08350    03036 Chromosome and associated proteins [BR:pspg03036]     AK823_08350    03400 DNA repair and recombination proteins [BR:pspg03400]     AK823_08350 DNA replication proteins [BR:pspg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AK823_08350 Chromosome and associated proteins [BR:pspg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AK823_08350 DNA repair and recombination proteins [BR:pspg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AK823_08350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 VWA_3 Motif Other DBs NCBI-ProteinID:  AMN49875 UniProt:  A0A7U4QQK7 LinkDB All DBs Position complement(2056837..2057109) Genome browser AA seq 90 aa AA seqDB search MNKSELIDSIADKSGLNKTQAGDALNAVMESVGEALEAGESISLVGFGTFSVKDRKARTG RNPKTGEELSIPASKVPSFKAGKNLKERLN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataagtcagaattaattgatagcattgcagacaaaagcggcctaaacaaaacccaa gctggtgatgcattgaacgccgttatggaaagcgttggtgaagctctagaagctggtgaa agtatctcattagttggttttggtacgtttagcgtaaaagaccgtaaagcacgcactggc cgtaatcctaaaacaggtgaagagctaagtatccctgcaagtaaagtaccaagctttaaa gccggtaaaaacttaaaagagcgcttaaactaa

DBGET integrated database retrieval system