Pseudohongiella spirulinae: PS2015_1509 Help Entry PS2015_1509       CDS       T04158                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pspi  Pseudohongiella spirulinae Pathway pspi01100   Metabolic pathways pspi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pspi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PS2015_1509    00074 Mycolic acid biosynthesis     PS2015_1509   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PS2015_1509 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  ALO46166 UniProt:  A0A0S2KCW7 LinkDB All DBs Position 1664780..1665013 Genome browser AA seq 77 aa AA seqDB search MSSIEERVKKIVCEQLGVKEEDVKASSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINQHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgcgtgaaaaaaattgtctgcgagcagcttggggtaaaggaa gaagacgttaaggcttcctcttcattcgttgaagatctgggcgctgattctttggacacc gtggaattggttatggctctcgaagaagagtttgaaactgaaattccggacgaagaagcc gagaaaatcactactgttcagctggcaattgactacatcaaccagcacctgtaa

DBGET integrated database retrieval system