Paenibacillus spongiae: L1F29_02050
Help
Entry
L1F29_02050 CDS
T09530
Symbol
cydD
Name
(GenBank) thiol reductant ABC exporter subunit CydD
KO
K16014
ATP-binding cassette, subfamily C, bacterial CydCD
Organism
pspn
Paenibacillus spongiae
Pathway
pspn02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pspn00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
L1F29_02050 (cydD)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pspn02000
]
L1F29_02050 (cydD)
Transporters [BR:
pspn02000
]
ABC transporters, eukaryotic type
ABCC (CFTR/MRP) subfamily
ABCC-BAC subgroup
L1F29_02050 (cydD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
SMC_N
AAA_21
AAA_29
RsgA_GTPase
AAA_22
AAA_18
MMR_HSR1
AAA_23
ABC_ATPase
AAA_16
Zeta_toxin
ATP-synt_ab
AAA_25
DUF87
AAA_30
AAA_24
NTPase_1
NACHT
nSTAND1
T2SSE
Septin
DUF6079
HUTI_composite_bact
Motif
Other DBs
NCBI-ProteinID:
UVI30686
UniProt:
A0ABY5S9S9
LinkDB
All DBs
Position
466368..470057
Genome browser
AA seq
1229 aa
AA seq
DB search
MIKQLFKQVQGTRKLFAASVIIGVAGGLLLIVQAIYMARVTNGAFLGGQSLAALLPALYV
LLGVIGLRAVLQAAGDYASTQMAQRIKSDLRLRLVRKLAELGPDYAKGERSGELINTVYE
GVEQLENYLAKYLPQVALSTFIPAAVFFVVAGTDWLSAVIFAVTLPLLVILMILIGKAAK
AKTDRQFQLLGRLGGHFHEMLRGLPTLKMFNRSRAQIDIIARISEEHRRSTMGTLRLAFL
SAFVMELFASLSTAIVAVFLGLRLIEGEIGFEHAFLVLLLAPEFYNPVRTLGTQFHAGMN
GVTAAGRIFDILNTEPPGWVEKEGAAVLPPKPEGYRIVFEGVTVQYAGEARPALSDISLT
LEPGERIALVGPTGAGKSTLLDLLQGFIKPASGRILVDGIDLSQISMSWWRNQQSVLSQH
PHLFHGTIGDNIRISKPDASGAEVAAAAEAAQAAAFIQALPRQYDTPLGESVRLSGGQAQ
RIAIARALLREAPLLMLDEPTAGLDLANEANITKTLEPLLRGRMSITAAHRLSTIRASDR
IVVLAGGRIVEAGTADDLAAAGGLYADMLAAARADEDAAAERRDAEYIPAADHMRQRSEE
GARALPPAAGIASPADAAPVRRRKTFVRLLQFVRPYKWWTLLAILLGFGTVATNVGLMGT
SGYLIAKAALRPETVLLLYVPIVGVRFFGIARGVFRYVERLVSHDLTFRILKRLRVWLYE
RLEPRGVQLLENKRSGDLLGSVISDVEQLQNLYLRVIAPPVVAALTVLLGFVFMANYDLR
LGMLLAGMLLTAGVVIPWLSHRIGSSGGRDFVQARSEIYEQTSDLLTGLPTLILYGQAQN
MEERILTIQRRLDAHQTKQNRISAFTGGSMSLLTHLTMWLMLLAIIPLTISGHIDSYMIP
ALVLASFACFEAVMPLPLSFQLFGQTISAGDRLFRLADEAGDQAQLVKPAKPTNPAKPAN
PAPASEEVSEAGEADVRWQAQVSGLSFRYAPEEPYALRDLSLTLVQGKQIAIVGESGAGK
STLLQLLMKLRSYEEGSIAINGTELRDIAGESARAQFAVVSQNVQLFNATVAENLRLGRP
EASLDELREAARVARIDETIERLPEGYDTIIGEWGAKLSGGERQRLALARALVREAPAIL
FDEPGTGLDPLTEQAFTSHIEPLLGEKAVLWITHKLTGLERMDEIIVLQNGTVAERGAHQ
ELLERHGVYWKLWKLQRDRERTRELAEVR
NT seq
3690 nt
NT seq
+upstream
nt +downstream
nt
atgatcaaacaactgttcaaacaggtgcagggcacccgcaagctgttcgcggctagcgta
atcatcggtgtggcaggcggcttgctgctgattgttcaagcgatctatatggcaagagtt
acgaacggggctttcctcggcgggcaaagcttggctgcgctgctgcctgcgctgtacgtg
ctgcttggcgttatcggactccgagccgtcctgcaggcagcaggcgactatgcgtcgacg
cagatggcgcagcgcatcaagagcgatctgcgcctccggctggtccgcaagcttgccgag
ctgggacccgattacgcgaagggcgagcggagcggggaactgatcaacacggtctatgaa
ggcgtggagcagttggaaaattatttggcgaagtatttgccccaagtggcgctctctacg
ttcattcccgctgccgtgttcttcgtcgtagcgggaacggactggttatcggcggttatc
ttcgcagtgacgctgccgctgctggtcatcttgatgattctgatcggcaaggcggcgaag
gcgaagacggaccgccagttccagctgcttggccggcttggcgggcactttcatgagatg
ctgcggggcttgccgacgctgaagatgttcaaccgcagccgggcgcagatcgacatcatt
gcgcggatcagcgaagagcaccggcgctcgacgatggggacgctgcggctggcctttctg
tccgcgttcgttatggagctgttcgcgtcattaagcaccgctatcgtagccgtgttcctc
ggcctgcgtcttattgaaggcgaaatcggcttcgagcacgccttcctggtgctgcttctg
gctcccgagttctataatcccgtccggacgctggggactcaatttcacgccgggatgaac
ggcgtgacggcagcggggcgaatcttcgacatcttgaacacggaacctccgggatgggtc
gagaaggaaggggccgccgtattgccgccgaagccggaaggataccgcatcgtattcgaa
ggcgtcaccgtccaatatgccggcgaagcccgtccggcgctgtccgatatttcgctcacg
ctcgaaccgggcgagcggatcgccttggtcggacctaccggggcagggaagagcacgctg
ctggatctgctgcagggctttatcaaacctgcttcggggcgtattctggttgacggtatc
gatctgtcgcagatctccatgtcatggtggcggaatcagcagtcggtattgtcgcagcac
ccccatctcttccacgggacgataggcgacaacattcgaatcagcaagccggatgcaagc
ggagcggaggtagccgcggcggcggaggccgctcaggcggctgctttcattcaggcgctg
ccgcggcagtacgacacgccgctcggggaatcggtcaggctgtccggcggacaggcgcag
cggatcgcgatcgcgcgggcgcttctgagagaggcgcctctgctcatgctggatgaaccg
acggcgggactggatctcgccaatgaagcgaatatcacaaagacacttgaaccgctgctg
cgcgggcgcatgtccattacggcagcgcatcggctgagcacgattcgcgcgtcggaccgg
atcgtcgtactggccggcggacggatcgtcgaagccggtaccgcggatgatctggctgca
gccggcggactgtatgccgatatgttagcggctgcgcgagcggatgaggatgcagctgcg
gagcgcagagacgcggaatacattccggcggccgatcatatgcgtcagcggtcggaagaa
ggtgcgagggctctgcctcctgctgcgggtatagcatcgccggcagatgccgcacctgtc
agaagacggaagaccttcgtccgcctgctgcaattcgtccgtccttacaagtggtggacg
ctgctcgcgatcctgctcggattcggaaccgtcgccactaacgtcggtctgatgggaacg
tcaggctatctgattgccaaggctgcgctgcggccggagacggttctgctgctctacgtc
ccgattgtcggcgtgcgtttcttcgggattgcgcggggggtgttccgttatgtggagcgg
ctcgtttcccatgatctcaccttccgcattctgaagcggctgcgggtatggctgtacgaa
cggctggagccaagaggggtgcagctgcttgagaacaaacgaagcggcgatttgctgggc
tctgtcatcagcgatgtggagcagctgcagaatttatatctgcgcgtcatcgcgccgccg
gttgttgccgctctgaccgtgctgctcggattcgtatttatggcgaattatgatctgcgg
ctgggcatgctgctagcaggcatgctgctcacggcgggggttgtcattccatggctaagc
caccggatagggagcagcggcggaagggacttcgtgcaggcacgatcggaaatttatgaa
caaacctccgacttgctgacggggctgccgacgttgattctgtacgggcaagcgcagaat
atggaagaacgcattcttacgattcagcgccgcttggatgcccatcagacgaagcagaac
cggatctcggccttcacgggaggctctatgtccctcttgacgcatttgaccatgtggctg
atgctgcttgccattatcccgcttacgatatcgggccatatcgacagctacatgattccc
gcgctggtgctcgcctcgttcgcctgcttcgaagcggtcatgccgcttccgctgtcgttc
cagctgttcgggcaaacgatttccgccggcgaccggctgttccggctggccgatgaagcc
ggcgatcaggcacaattggtcaaaccggccaaaccgaccaatccggccaaaccggccaat
ccggctccggcttcggaggaagtgtctgaagcgggtgaagccgatgtaaggtggcaggcg
caggtaagcggattgtcgttccgttacgcgcccgaagagccctacgcgctgcgtgatctg
tcgctaacgctcgttcaagggaagcaaattgcgatcgttggcgaaagcggcgccgggaag
agcacgctcctgcagctgctgatgaagctgcggtcttacgaggaaggctccattgcgatt
aatggaacggagctgcgcgatatcgccggcgagtcggctcgggctcaatttgcggtcgta
tcgcagaatgtgcagttattcaacgcgacggtagccgagaatttacggcttggccgtcct
gaggcgtcgctcgatgagctgcgtgaagcagcccgtgtggcgagaattgacgagacgatc
gagcggctgccggaaggctacgatacgatcatcggcgaatggggagcgaagctgtccgga
ggagagcggcagcggcttgcgctggcgcgggcgctcgtccgggaggccccggcaattcta
ttcgacgagccggggacggggcttgatccgttaaccgagcaggcctttaccagccatata
gaaccgctgctcggcgagaaagcggtcctgtggattacgcataagctgacaggtctggag
cgaatggacgaaatcatcgttcttcagaacgggacggtagcggagagaggcgcgcatcag
gagctgctggagcgtcacggcgtctattggaagctgtggaagctgcagagggaccgggag
cggacgcgcgaattggcggaggttcgttag
DBGET
integrated database retrieval system