Paenibacillus spongiae: L1F29_24815 Help Entry L1F29_24815       CDS       T09530                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pspn  Paenibacillus spongiae Pathway pspn00998   Biosynthesis of various antibiotics pspn01100   Metabolic pathways pspn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pspn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L1F29_24815    00074 Mycolic acid biosynthesis     L1F29_24815   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L1F29_24815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UVI28644 UniProt:  A0ABY5S413 LinkDB All DBs Position complement(5480037..5480270) Genome browser AA seq 77 aa AA seqDB search MKSELRNQVRSILSEVLNADLSSIDNPARNELAAWDSLKHMELILRLEEQYHIRFSIREV ADIQCLDDIVGIIEVKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgaaaagtgaattgcgtaatcaggttcggtctatcttatcggaggtactgaacgctgat ttgtcatcgatagacaatccggcaaggaatgaactggcagcttgggattcattgaagcat atggagctcattctccgccttgaggagcaatatcacattcgcttttcaatccgggaggta gcggatattcaatgcttggatgatatcgtggggatcatagaggtgaaatcgtga

DBGET integrated database retrieval system