Pseudoalteromonas sp. PS1M3: PS1M3_12410 Help Entry PS1M3_12410       CDS       T11044                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psps  Pseudoalteromonas sp. PS1M3 Pathway psps01100   Metabolic pathways psps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PS1M3_12410 (acpP)    00074 Mycolic acid biosynthesis     PS1M3_12410 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PS1M3_12410 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Motif Other DBs NCBI-ProteinID:  BBW91154 LinkDB All DBs Position 1:1397318..1397554 Genome browser AA seq 78 aa AA seqDB search MSDIQERVKKIIIEQLGVKEEEVKNESSFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQSAIDYVTAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatccaagaacgcgtaaaaaaaattatcattgaacaactaggtgttaaagaa gaagaagttaaaaacgaatcttctttcgtagatgacctaggtgcagattctcttgatact gtagaactagtaatggctcttgaagaagagtttgacactgagatcccagacgaagaagct gaaaagatcactacagttcaaagcgcaatcgattacgtaacagctcacgctgagtaa

DBGET integrated database retrieval system