Pseudoalteromonas sp. PS1M3: PS1M3_37910 Help Entry PS1M3_37910       CDS       T11044                                  Symbol hupB Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism psps  Pseudoalteromonas sp. PS1M3 Brite KEGG Orthology (KO) [BR:psps00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:psps03032]     PS1M3_37910 (hupB)    03036 Chromosome and associated proteins [BR:psps03036]     PS1M3_37910 (hupB)    03400 DNA repair and recombination proteins [BR:psps03400]     PS1M3_37910 (hupB) DNA replication proteins [BR:psps03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PS1M3_37910 (hupB) Chromosome and associated proteins [BR:psps03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PS1M3_37910 (hupB) DNA repair and recombination proteins [BR:psps03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PS1M3_37910 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 UBA_HYPK HU-DNA_bdg Arteri_nsp7a Motif Other DBs NCBI-ProteinID:  BBW93704 LinkDB All DBs Position 2:563134..563409 Genome browser AA seq 91 aa AA seqDB search MNKAQLVEKIATDAEISKAAATRALDAFTGAVTSALKEGDSVALVGFGTFSVKERAARTG RNPQTGAEIQIAAATIPSFKAGKGLKDQVNL NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaataaagctcaattagttgaaaaaattgctactgacgcggaaatttctaaagccgct gctacacgtgctcttgacgcgtttactggcgctgtaacttctgcacttaaagaaggtgat tcagtagcattagttggttttggtactttctcagttaaagaacgtgctgcacgcacaggc cgtaaccctcaaacgggtgctgagatccaaatcgcagcggcaactatcccaagctttaaa gcaggtaaaggtcttaaagaccaagtaaacctataa

DBGET integrated database retrieval system