KEGG   Pandoraea sputorum: NA29_02310
Entry
NA29_02310        CDS       T03554                                 
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00190  Oxidative phosphorylation
pspu01100  Metabolic pathways
pspu02020  Two-component system
Module
pspu_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NA29_02310
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NA29_02310
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    NA29_02310
Enzymes [BR:pspu01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     NA29_02310
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: AJC15166
UniProt: A0A239SXU5
LinkDB
Position
complement(5293211..5293825)
AA seq 204 aa
MSNNQKRAVDSNRRNLLIATSVAGGVGGVATLVPFVSSLEPSERAKAGGAPVEADVSALR
PGEKMTVAWRGLPVWIVRRTPDEMASLSKVTAELADPDSKETFSFPMPDYAKNEFRTRVE
HKDLLVVIGVCTHLGCIPSGPYVANTIPALGQDPGFLCPCHGSTYDMSGRVFKNKPAPKN
LDVPRFMFLSDTKIVIGKDEKGEA
NT seq 615 nt   +upstreamnt  +downstreamnt
atgagtaacaatcagaaacgtgccgtcgacagcaaccgccggaacctattgattgcaacg
tccgtagctggaggcgtaggcggcgttgcaacactggttcctttcgtcagttccctcgaa
ccttcggagcgcgccaaggctggcggagcgcccgtcgaagccgatgtcagcgcgttgcgg
cccggcgagaagatgacggtcgcgtggcgcggccttcccgtgtggatcgtacgccgcaca
ccggacgaaatggcttcgctgtccaaagtgactgccgaactggccgatccggactccaag
gaaacgttttcgtttccgatgcccgattacgccaagaacgagttccgcacgcgcgtcgag
cataaggatctgctcgtcgtcatcggcgtctgtacgcaccttggctgcatcccttccggt
ccctatgtggcgaacaccatcccggcccttggccaggacccgggcttcctgtgcccgtgc
catggttcgacctacgatatgtctggccgtgttttcaagaacaagccggcgccaaagaat
ctcgacgttcctcgtttcatgttcctgagcgacaccaagatcgtgatcggtaaagacgaa
aaaggagaagcgtaa

DBGET integrated database retrieval system