Pandoraea sputorum: NA29_16995 Help Entry NA29_16995        CDS       T03554                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pspu  Pandoraea sputorum Brite KEGG Orthology (KO) [BR:pspu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pspu03032]     NA29_16995    03036 Chromosome and associated proteins [BR:pspu03036]     NA29_16995    03400 DNA repair and recombination proteins [BR:pspu03400]     NA29_16995 DNA replication proteins [BR:pspu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NA29_16995 Chromosome and associated proteins [BR:pspu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NA29_16995 DNA repair and recombination proteins [BR:pspu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NA29_16995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AJC17239 UniProt:  A0A239SJR3 LinkDB All DBs Position 2916278..2916556 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGVTGASKAQTGETIDALLETVKKAVAKGDSVQLIGFGSFGSGKRAARTG RNPKTGEAIKIPAAKTVKFTAGKAFKDAVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactaatcgacgccgtcgctggtgttacgggtgcaagcaaggctcaa actggcgaaaccatcgacgctctgctcgagaccgtcaagaaggcagtcgccaagggtgac tcggttcagttgatcggcttcggctcgttcggttcgggcaagcgcgctgcgcgtaccggc cgcaacccgaagactggcgaagcgatcaagatcccggcagccaagaccgtgaagttcacg gctggcaaggcgttcaaggacgctgtgaacaagaagtaa

DBGET integrated database retrieval system