Pandoraea sputorum: NA29_25040 Help Entry NA29_25040        CDS       T03554                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pspu  Pandoraea sputorum Pathway pspu00998   Biosynthesis of various antibiotics pspu01100   Metabolic pathways pspu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pspu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NA29_25040    00074 Mycolic acid biosynthesis     NA29_25040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NA29_25040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AJC18401 UniProt:  A0A239SSK4 LinkDB All DBs Position complement(4747420..4747659) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEEEFEIEIPDEEA EKITTVQQAIDFASSQKKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacattgagcaacgcgtcaagaagatcgtcgccgaacaacttggcgtcgcggaa gccgacattaagaacgaatccagcttcgtgaacgatctcggcgctgactcgctcgatacg gttgagctggtgatggccctggaagaagagttcgagatcgagatcccggacgaagaagca gaaaagatcaccaccgtgcaacaagctatcgatttcgcctcgtcgcagaagaaggcgtaa

DBGET integrated database retrieval system