Paraburkholderia sprentiae: BJG93_00935 Help Entry BJG93_00935       CDS       T04610                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pspw  Paraburkholderia sprentiae Pathway pspw00998   Biosynthesis of various antibiotics pspw01100   Metabolic pathways pspw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pspw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJG93_00935    00074 Mycolic acid biosynthesis     BJG93_00935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJG93_00935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  APA84119 UniProt:  A0A1I9YCT6 LinkDB All DBs Position 1:complement(2611841..2612092) Genome browser AA seq 83 aa AA seqDB search MSETEILERIRAIFKENFAIEPERVTPDARLFDELDLDSIDAVDLAIKLQEMTGRRIKPE DFKSVRTVGDVIDAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgtctgagactgagattcttgagcgcatccgcgcgatcttcaaggaaaacttcgcgatc gagccggagcgcgtgacacccgacgctcgcctgttcgacgaactcgatctcgacagcatc gacgcggtcgatctcgcgatcaagctgcaggaaatgaccggccgccgcatcaagccggag gacttcaagtccgtgcgcacggtcggcgacgtgatcgacgcggtcgaatcgctgctcgcg gcgcaaggctga

DBGET integrated database retrieval system