Paraburkholderia sprentiae: BJG93_01630 Help Entry BJG93_01630       CDS       T04610                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pspw  Paraburkholderia sprentiae Pathway pspw00998   Biosynthesis of various antibiotics pspw01100   Metabolic pathways pspw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pspw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJG93_01630 (acpP)    00074 Mycolic acid biosynthesis     BJG93_01630 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJG93_01630 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  APA84245 UniProt:  A0A1I9YD62 LinkDB All DBs Position 1:complement(2462325..2462564) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcggaacaactgggcgttgcggaa gcggaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgccgactcgctcgacacc gttgagctcgtgatggctctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcaccaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcctaa

DBGET integrated database retrieval system