Paraburkholderia sprentiae: BJG93_12815 Help Entry BJG93_12815       CDS       T04610                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pspw  Paraburkholderia sprentiae Brite KEGG Orthology (KO) [BR:pspw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pspw03032]     BJG93_12815    03036 Chromosome and associated proteins [BR:pspw03036]     BJG93_12815    03400 DNA repair and recombination proteins [BR:pspw03400]     BJG93_12815 DNA replication proteins [BR:pspw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BJG93_12815 Chromosome and associated proteins [BR:pspw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BJG93_12815 DNA repair and recombination proteins [BR:pspw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BJG93_12815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  APA86183 UniProt:  A0A1I9YIQ0 LinkDB All DBs Position 1:3603082..3603360 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKSVSKGEAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDSVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgctgtcgcaggacagacgggcgccagcaaggctcaa accggtgaaacgctggacacgttgcttgaagtgatcaagaagtctgtgtcgaagggtgag gcggtccagttgatcggcttcggcagctttggttcgggcaagcgcgcagcgcgtacgggt cgcaatccgaagaccggcgaaactatcaagattccggccgccaagaccgtcaagttcacg gcaggcaaggcgttcaaggactcggtcaacaagcgctaa

DBGET integrated database retrieval system