Paraburkholderia sprentiae: BJG93_20650 Help Entry BJG93_20650       CDS       T04610                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pspw  Paraburkholderia sprentiae Brite KEGG Orthology (KO) [BR:pspw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pspw03036]     BJG93_20650    03400 DNA repair and recombination proteins [BR:pspw03400]     BJG93_20650 Chromosome and associated proteins [BR:pspw03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BJG93_20650 DNA repair and recombination proteins [BR:pspw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BJG93_20650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N DUF4162 Motif Other DBs NCBI-ProteinID:  APA87834 UniProt:  A0A1I9YNF1 LinkDB All DBs Position 2:complement(2445540..2445806) Genome browser AA seq 88 aa AA seqDB search MKEREAQQRLFERDENLRERMIAWIRRRMDDHNITLEALAEWLEADANAVSAVRYRDAFG NTWDGHGDKPAWLARAIHAGQSIDHFRC NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaagaacgagaagcacaacaacgactgttcgaacgtgatgagaacctgcgcgagcgc atgatcgcgtggatccgccgacgcatggacgaccacaacatcacactggaagcgctggcc gaatggctcgaagccgatgcgaacgccgtctctgcggtgcggtatcgcgacgcgttcggc aacacgtgggacggtcacggcgataaacctgcgtggctcgcgcgcgcgattcacgccgga caaagcatcgatcatttccgctgctaa

DBGET integrated database retrieval system