Punctularia strigosozonata: PUNSTDRAFT_86232 Help Entry PUNSTDRAFT_86232  CDS       T03131                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism psq  Punctularia strigosozonata Pathway psq03050   Proteasome psq03440   Homologous recombination Brite KEGG Orthology (KO) [BR:psq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     PUNSTDRAFT_86232   09124 Replication and repair    03440 Homologous recombination     PUNSTDRAFT_86232  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psq03019]     PUNSTDRAFT_86232    04131 Membrane trafficking [BR:psq04131]     PUNSTDRAFT_86232    03051 Proteasome [BR:psq03051]     PUNSTDRAFT_86232    03400 DNA repair and recombination proteins [BR:psq03400]     PUNSTDRAFT_86232 Messenger RNA biogenesis [BR:psq03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      PUNSTDRAFT_86232 Membrane trafficking [BR:psq04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     PUNSTDRAFT_86232 Proteasome [BR:psq03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      PUNSTDRAFT_86232 DNA repair and recombination proteins [BR:psq03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      PUNSTDRAFT_86232 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Sep15_SelM Motif Other DBs NCBI-GeneID:  18886225 NCBI-ProteinID:  XP_007383040 JGI:  86232 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MSSDASTSKAKTDAAALEESNKEQNAPPTLGVLEEDDEFEEFPVQDWDDSETDLKHLGGA APGAAQSGGNKLWEDNWDDDDIEDEFSMQLRNELAKTGKGGDAMQT NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcctccgacgcatccacatccaaagcaaagacagacgctgccgcgctagaggaatcc aacaaagaacagaatgccccgcccactctcggcgtattggaagaggacgacgagtttgag gagttccctgtacaagactgggacgactcggagacagatttgaagcaccttggcggtgcc gctccaggtgccgcgcagtcgggcggcaacaagctctgggaggacaactgggacgacgac gacatcgaggacgagttcagcatgcagctacgcaacgaactggcgaaaactgggaagggc ggagatgcgatgcagacataa

DBGET integrated database retrieval system