Punctularia strigosozonata: PUNSTDRAFT_95425 Help Entry PUNSTDRAFT_95425  CDS       T03131                                  Name (RefSeq) protein translocase SEC6   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism psq  Punctularia strigosozonata Pathway psq03060   Protein export psq04141   Protein processing in endoplasmic reticulum psq04145   Phagosome Brite KEGG Orthology (KO) [BR:psq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PUNSTDRAFT_95425    04141 Protein processing in endoplasmic reticulum     PUNSTDRAFT_95425  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PUNSTDRAFT_95425  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psq04131]     PUNSTDRAFT_95425   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psq02044]     PUNSTDRAFT_95425 Membrane trafficking [BR:psq04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     PUNSTDRAFT_95425 Secretion system [BR:psq02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    PUNSTDRAFT_95425 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18886701 NCBI-ProteinID:  XP_007378889 JGI:  95425 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MSEKLREYLEVPQQFVQDGRQFMTRCTKPSRKEFTQICKAVAIGFSIMGFIGYFVKLIHI PINNILGEAHRHFRLLVVGYTRAAHRAYLF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtccgagaaactgcgcgaatatctcgaggtcccccagcaatttgttcaggatggaaga caattcatgacacggtgcacgaagccttcgcgcaaggagttcacccaaatatgcaaagcc gttgccattggattttctatcatgggcttcatcggatattttgtgaagctaattcatatt cccataaacaacatcctaggggaggcgcatagacacttccgcttgcttgttgttgggtac acccgagctgcacaccgtgcttatttattctga

DBGET integrated database retrieval system