Stutzerimonas stutzeri DSM 4166: PSTAA_0388 Help Entry PSTAA_0388        CDS       T01976                                  Symbol tatA Name (GenBank) translocation protein TatA   KO K03116   sec-independent protein translocase protein TatA Organism psr  Stutzerimonas stutzeri DSM 4166 Pathway psr03060   Protein export psr03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:psr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PSTAA_0388 (tatA)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     PSTAA_0388 (tatA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psr02044]     PSTAA_0388 (tatA) Secretion system [BR:psr02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    PSTAA_0388 (tatA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AEA82308 LinkDB All DBs Position complement(437787..438017) Genome browser AA seq 76 aa AA seqDB search MGFGGISVWQLLIILLIVIMLFGTKRLKGLGSDLGDAIKGFRKSMGTDEEKPGVEDKQNH TIDAQARKVEEPTKKD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggttttggcggcatcagcgtctggcaactactgatcatcctgctcatcgtcatcatg ctgttcggcaccaagcgcctcaagggcctgggctccgacctcggtgatgcgatcaagggc ttccgcaaatccatgggcaccgacgaggaaaagcctggcgtggaagacaagcagaatcac accatcgatgcgcaggcgcgcaaggtcgaagaaccgaccaagaaagactag

DBGET integrated database retrieval system