Stutzerimonas stutzeri DSM 4166: PSTAA_2722 Help Entry PSTAA_2722        CDS       T01976                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psr  Stutzerimonas stutzeri DSM 4166 Pathway psr01100   Metabolic pathways psr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSTAA_2722    00074 Mycolic acid biosynthesis     PSTAA_2722   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSTAA_2722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEA84601 LinkDB All DBs Position 2913768..2914016 Genome browser AA seq 82 aa AA seqDB search MNEKEILQALSQVFHDVFDDDDIVLTSETTADDIDGWDSQTHVLLIVAAEQRFGIKFRTA ELESLKNVGHFAQLIQTKLGGR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacgaaaaggaaattctccaggcgctgagccaggtcttccacgacgtgttcgacgat gacgatatcgtcctcacctccgaaaccaccgccgacgacatcgatggctgggacagccag acccatgtgctgctgatcgtggccgcagagcaacgcttcggcatcaagttccgcaccgcc gaactggaatcgctgaagaacgttggccacttcgcgcaactgatccagaccaaactcgga gggcgttga

DBGET integrated database retrieval system