Stutzerimonas stutzeri DSM 4166: PSTAA_2742 Help Entry PSTAA_2742        CDS       T01976                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psr  Stutzerimonas stutzeri DSM 4166 Pathway psr01100   Metabolic pathways psr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSTAA_2742 (acpP)    00074 Mycolic acid biosynthesis     PSTAA_2742 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSTAA_2742 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AEA84621 LinkDB All DBs Position complement(2931880..2932116) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaggct gagaagatcaccaccgttcaggaagccatcgattacatcaacgcgcacgcgcagtaa

DBGET integrated database retrieval system