Pseudoalteromonas sp. R3: ELR70_12075 Help Entry ELR70_12075       CDS       T10968                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psrr  Pseudoalteromonas sp. R3 Pathway psrr01100   Metabolic pathways psrr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psrr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ELR70_12075    00074 Mycolic acid biosynthesis     ELR70_12075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ELR70_12075 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF8312 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  AZZ97790 LinkDB All DBs Position 1:1657774..1658010 Genome browser AA seq 78 aa AA seqDB search MSDIQERVKKIIVEQLGVKEEEVKSEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatccaagaacgcgtaaaaaaaatcatcgttgagcaactaggtgttaaagaa gaagaagtaaaatcagaagcgtctttcgtagacgatctgggtgctgactctcttgacact gttgagctggtaatggctctggaagaagagttcgacactgaaatccctgatgaagaagct gagaaaatcactactgttcaggcagcgatcgactacgttactgctcacgctgagtaa

DBGET integrated database retrieval system