Pseudomonas sp. RU47: CCX46_21675 Help Entry CCX46_21675       CDS       T11150                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psru  Pseudomonas sp. RU47 Pathway psru01100   Metabolic pathways psru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psru00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCX46_21675    00074 Mycolic acid biosynthesis     CCX46_21675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCX46_21675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AZZ77654 LinkDB All DBs Position complement(4860476..4860712) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtggtcaacaccgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system