Pseudoxanthomonas sp. SE1: OY559_07305 Help Entry OY559_07305       CDS       T10619                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psse  Pseudoxanthomonas sp. SE1 Pathway psse01100   Metabolic pathways psse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OY559_07305 (acpP)    00074 Mycolic acid biosynthesis     OY559_07305 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OY559_07305 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  WFC43303 LinkDB All DBs Position 1533027..1533266 Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtgaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggcgccgactcgctggacacc gttgaactggtgatggcgctggaagaagagttcgaatgcgaaattccggacgaggaagcc gagaagatcacttcggtgcagcaggccatcgattacgtcaaggcgcacgtcaaggcgtaa

DBGET integrated database retrieval system