KEGG   Pseudomonas sp. SXM-1: DCC84_01225
Entry
DCC84_01225       CDS       T11095                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
pssx  Pseudomonas sp. SXM-1
Pathway
pssx00430  Taurine and hypotaurine metabolism
pssx00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:pssx00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DCC84_01225 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DCC84_01225 (tauD)
Enzymes [BR:pssx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     DCC84_01225 (tauD)
SSDB
Motif
Pfam: TauD NUFIP1
Other DBs
NCBI-ProteinID: QBQ08451
LinkDB
Position
complement(263182..264018)
AA seq 278 aa
MSSLTVTPLSTALGAQISGVDITQPLNIEDRDAIEQALLKHSVLFFRNQPINPQQQARFA
ANFGDLHIHPIYPNVPEQPEVLILDTAVTDVRDNAIWHTDVTFLPTPALGAVLSAKLLPE
FGGDTLWASGIAAYEALSEPFKKLLDGLTATHDFTRSFPLERYGNTPEDLARWEEARRKN
PPLSHPVIRTHPVSGRKSLFVSEGFTSKINELEPAESDVVLKLLFAHATRPEFTIRWRWQ
ENDVAFWDNRVTQHYAVDDYRPQRRVMHRATILGDVPF
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagcagcctgaccgtaacacctctcagcaccgcccttggcgcccagatcagtggcgtc
gacatcacccaaccgttgaacattgaagaccgcgacgccatcgaacaggcgctgctcaag
cattcggtgctgttcttccgcaaccagccgatcaacccgcagcaacaggcgcggttcgcg
gcgaatttcggcgacctgcacattcacccgatctaccccaacgtgccggagcagccagaa
gtgctgatcctcgacaccgccgtgaccgacgtgcgcgacaacgccatctggcacaccgac
gtgaccttcctcccgaccccggccctcggcgcggtgctcagcgccaagctgctgccggag
tttggtggcgatacgttgtgggccagcgggattgccgcgtatgaggcgctgtccgagccg
ttcaagaaactgttggacggtttgacggcaacccatgacttcacccgctccttcccgctg
gagcgttatggcaacacgccggaagatttggcgcgctgggaagaagcccggcgcaagaac
ccgccgctgtctcatccggtgattcgtacccacccggtgagcgggcgtaagtcgctgttc
gtcagcgaggggttcaccagcaagatcaacgaactggagccggcggaaagcgacgtggtg
ttgaagctgctgtttgcccatgcaacacggccggaattcaccattcgctggcgttggcag
gaaaatgacgtggcgttctgggataaccgcgtgacccagcattacgcggtggatgattac
cggccgcagcggcgggtgatgcatcgggcgacgattcttggagatgtgccgttctag

DBGET integrated database retrieval system