Pseudomonas syringae pv. tomato DC3000: PSPTO_1965 Help Entry PSPTO_1965        CDS       T00118                                  Name (GenBank) Hpt domain protein   KO K20976   histidine phosphotransfer protein HptB Organism pst  Pseudomonas syringae pv. tomato DC3000 Pathway pst02020   Two-component system pst02025   Biofilm formation - Pseudomonas aeruginosa Brite KEGG Orthology (KO) [BR:pst00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PSPTO_1965  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     PSPTO_1965  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02022 Two-component system [BR:pst02022]     PSPTO_1965 Two-component system [BR:pst02022]  Other families   SagS-HptB-HsbR (swarming activity and biofilm formation)    PSPTO_1965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hpt Motif Other DBs NCBI-ProteinID:  AAO55483 UniProt:  Q884X1 LinkDB All DBs Position 2152245..2152601 Genome browser AA seq 118 aa AA seqDB search MSIHLDYSVLSALQEVMEDEYPTLLDVFLKDSEQRLAQLRLAVETGNLDLQELSLTAHSF KGSSSNMGALQLSQLCHQLEERARQNDSSDLRDLIGRIGSEYLTVRGLFNAERQLFIS NT seq 357 nt NT seq  +upstreamnt  +downstreamnt gtgtcgattcatctggattacagcgtactgagtgccctgcaggaagtcatggaggacgaa tatccgactttgctggatgtattcctcaaggattccgagcagcgtctcgcccaactgcgc cttgcggttgaaaccggcaaccttgatcttcaggaactgagcctcacggcgcacagcttc aagggcagcagcagcaacatgggtgccctgcagctttcgcaattgtgtcaccagcttgag gagcgtgctcgtcagaacgattcctcggatctgcgagacctgatcggcaggataggcagc gaatacctgaccgtccgtggtttgttcaatgctgagcgccagctcttcatcagttga

DBGET integrated database retrieval system