Pseudomonas syringae pv. tomato DC3000: PSPTO_3374 Help Entry PSPTO_3374        CDS       T00118                                  Symbol nouK Name (GenBank) NADH dehydrogenase I, K subunit   KO K00340   NADH-quinone oxidoreductase subunit K [EC:7.1.1.2] Organism pst  Pseudomonas syringae pv. tomato DC3000 Pathway pst00190   Oxidative phosphorylation pst01100   Metabolic pathways Module pst_M00144   NADH:quinone oxidoreductase, prokaryotes Brite KEGG Orthology (KO) [BR:pst00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     PSPTO_3374 (nouK) Enzymes [BR:pst01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      PSPTO_3374 (nouK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 NAD4L ATP1G1_PLM_MAT8 GT2_TM_C Motif Other DBs NCBI-ProteinID:  AAO56852 UniProt:  Q87ZQ0 LinkDB All DBs Position 3813592..3813900 Genome browser AA seq 102 aa AA seqDB search MNAIPLEHGLAVAGVLFCLGLVGLMVRRNILFVLMSLEIMMNAAALAFVVAGSRWAQPDG QVMFILVISLAAAEASIGLAILMQLYRRFHTLDIDAASEMRG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaatgctatccctcttgaacacggtctggcggttgccggggtcctgttctgcctgggt ctggtcggcctgatggtgcgccgcaacattctctttgtgttgatgagcctggaaatcatg atgaacgccgctgctctggcgtttgtagttgccggcagtcgctgggcgcaaccggatgga caggtcatgttcatcctggtgatcagccttgcggcagccgaggccagtatcggcctggcg atcctgatgcaactgtatcgccgcttccacactctcgatatcgatgctgccagcgagatg cgcggatga

DBGET integrated database retrieval system