Pseudomonas syringae pv. tomato DC3000: PSPTO_3831 Help Entry PSPTO_3831        CDS       T00118                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pst  Pseudomonas syringae pv. tomato DC3000 Pathway pst00998   Biosynthesis of various antibiotics pst01100   Metabolic pathways pst01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pst00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSPTO_3831 (acpP)    00074 Mycolic acid biosynthesis     PSPTO_3831 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSPTO_3831 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AAO57299 UniProt:  P80923 LinkDB All DBs Position complement(4339190..4339426) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKSEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaacttggcgtcaaatca gaagaggttgtcaacactgcttctttcgttgaagacctgggcgctgactccctggacacc gttgagctggtaatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcg gaaaagatcacgaccgttcaagcagcaatcgactacgtcaacagccatcaggcttaa

DBGET integrated database retrieval system