Pseudomonas syringae pv. tomato DC3000: PSPTO_5094 Help Entry PSPTO_5094        CDS       T00118                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism pst  Pseudomonas syringae pv. tomato DC3000 Pathway pst00998   Biosynthesis of various antibiotics pst01100   Metabolic pathways pst01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pst00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSPTO_5094    00074 Mycolic acid biosynthesis     PSPTO_5094   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSPTO_5094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  AAO58521 UniProt:  Q87V47 LinkDB All DBs Position 5794849..5795109 Genome browser AA seq 86 aa AA seqDB search MNMQTREDIFEILRAAMVELFELEPERVTLDANLYQDLEIDSIDAVDLIDHIKRKTGKKI AAEEFKSVRTVDDVVEAVYRLVNAAE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttgaacatgcaaacccgtgaagacatcttcgaaatcctccgcgccgcgatggtggaactg ttcgaactggagcctgaaagggtcacgctggacgccaacctgtatcaggacctggaaatc gacagcatcgatgccgtggacctgatcgaccacatcaaacgcaagaccggcaaaaagatt gctgcagaagaattcaagtcggtcagaaccgtcgacgacgtggtcgaggccgtctaccgc ctggtcaacgcagccgaatga

DBGET integrated database retrieval system