KEGG   Paenibacillus stellifer: PSTEL_16390
Entry
PSTEL_16390       CDS       T03335                                 
Name
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
pste  Paenibacillus stellifer
Pathway
pste02020  Two-component system
pste02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pste00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSTEL_16390
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PSTEL_16390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pste02022]
    PSTEL_16390
   02035 Bacterial motility proteins [BR:pste02035]
    PSTEL_16390
Two-component system [BR:pste02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   PSTEL_16390
Bacterial motility proteins [BR:pste02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSTEL_16390
SSDB
Motif
Pfam: Response_reg B12-binding HydF_dimer Peripla_BP_6
Other DBs
NCBI-ProteinID: AIQ64442
UniProt: A0A089LU89
LinkDB
Position
complement(3408815..3409180)
AA seq 121 aa
MANRILIVDDAAFMRMMIRDILSKNGFEVVGEAQDGSQAIEKFKELRPDLITMDITMPEM
DGIAALKEIKKVDANAKVIMCSAMGQQAMVIDAIQAGAKDFIVKPFQADRVIEAINKTLG
V
NT seq 366 nt   +upstreamnt  +downstreamnt
atggctaaccgaattttgatcgtagacgatgctgcttttatgagaatgatgattcgcgat
attttgtccaaaaatgggttcgaagtagtaggggaagcccaggacggttcccaggcgatt
gaaaaattcaaagaactgcgccccgacttgattacaatggatattaccatgcctgaaatg
gacggcatcgcagcattgaaggaaattaagaaggttgacgctaacgcgaaagtcattatg
tgctccgcaatgggccagcaagctatggtaatcgacgccattcaagccggcgctaaggac
tttatcgttaagccattccaagctgaccgcgttatcgaagccattaacaaaacgcttggc
gtttag

DBGET integrated database retrieval system