Paenibacillus stellifer: PSTEL_25225 Help Entry PSTEL_25225       CDS       T03335                                  Name (GenBank) ATP synthase F0F1 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pste  Paenibacillus stellifer Pathway pste00190   Oxidative phosphorylation pste01100   Metabolic pathways Module pste_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pste00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     PSTEL_25225  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pste00194]     PSTEL_25225 Photosynthesis proteins [BR:pste00194]  Photosystem and electron transport system   F-type ATPase [OT]    PSTEL_25225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5693 Motif Other DBs NCBI-ProteinID:  AIQ65923 UniProt:  A0A089M390 LinkDB All DBs Position complement(5297826..5298056) Genome browser AA seq 76 aa AA seqDB search MGVMAYIAAAIAVGLGALGAGIGNGLIVSKTVEGIARQPEAKSTLQTTMFIGVGLVEALP IIGVVLAFIFYANAGA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggagttatggcatacatcgcggctgcaatcgcggtaggtttgggcgctcttggcgcc ggtatcggtaacggtctgatcgtaagtaaaacggtagaaggtatcgcccgtcagcctgaa gctaagtccacgctgcagacaacaatgtttatcggtgtaggtctggtcgaagccctgccg attatcggtgtcgttcttgccttcattttctacgcaaacgctggagcataa

DBGET integrated database retrieval system