Paracoccus stylophorae: JHW45_02860 Help Entry JHW45_02860       CDS       T08951                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism pstl  Paracoccus stylophorae Pathway pstl02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pstl00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     JHW45_02860  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pstl02035]     JHW45_02860 Bacterial motility proteins [BR:pstl02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     JHW45_02860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  WCR11360 LinkDB All DBs Position 589316..589564 Genome browser AA seq 82 aa AA seqDB search MQITLPPTPSAHQDHAANPVEGLEQAFLEEMLKYCGPRAASDGFSGGVGEDQFGSFLTRE YARIMARHLDLGFATLAQKVVQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcagatcaccctgccgccgacgccgtcggcacaccaggatcacgccgcaaaccctgtc gaaggtctggaacaggcgtttcttgaggaaatgttgaaatattgcggcccgcgcgcagcc agtgacggattttccggcggtgtgggcgaggatcagttcggcagtttcctgacgcgtgaa tacgcccggatcatggcgcggcatctggatctgggattcgcgactcttgcgcagaaggtg gtgcaatga

DBGET integrated database retrieval system