Paracoccus stylophorae: JHW45_04945
Help
Entry
JHW45_04945 CDS
T08951
Name
(GenBank) acetolactate synthase 3 large subunit
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
pstl
Paracoccus stylophorae
Pathway
pstl00290
Valine, leucine and isoleucine biosynthesis
pstl00650
Butanoate metabolism
pstl00660
C5-Branched dibasic acid metabolism
pstl00770
Pantothenate and CoA biosynthesis
pstl01100
Metabolic pathways
pstl01110
Biosynthesis of secondary metabolites
pstl01210
2-Oxocarboxylic acid metabolism
pstl01230
Biosynthesis of amino acids
Module
pstl_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pstl_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
pstl00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
JHW45_04945
00660 C5-Branched dibasic acid metabolism
JHW45_04945
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
JHW45_04945
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
JHW45_04945
Enzymes [BR:
pstl01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
JHW45_04945
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_M
TPP_enzyme_N
DUF1674
Motif
Other DBs
NCBI-ProteinID:
WCR11724
UniProt:
A0ABY7SXT1
LinkDB
All DBs
Position
complement(996690..998444)
Genome browser
AA seq
584 aa
AA seq
DB search
MSRTMTGARMVVEALRDQGVDTVFGYPGGAVLPIYDEIFQQNDITHVLVRHEQGAVHMAE
GYARSTGKPGVVLVTSGPGATNAVTGLTDALLDSIPLVVLSGQVPTFLIGTDGFQEADTV
GITRPCTKHNWLVKDPGKLAETIHKGFHVATSGRPGPVLIDIPKDVQFATAEYVGPKQVE
PARYQPVRKGDTAAITRLVELIEQAERPILYTGGGVINSGPGASQLLRELADATGIPVTS
TLMGLGAYPASGRNWIGMLGMHGLYEANLAMHDCDLMINLGARFDDRITGRVADFSPGSV
KVHVDIDPSSINKVIRVDLPIIGDVGHVLEDLLKIWKSRGRKVNTAALGQWWERIEGWKS
KNCLFFRNSDKIIKPQHALQRLEALTADHDRYVTTEVGQHQMWAAQYLGFDEPNRWMTSG
GLGTMGYGLPASIGVQMAHPDALVINVAGDASWLMNMQEMGTAVQFRLPVKQFILNNERL
GMVRQWQQLLHGERYSQSWSDSLPDFVKLAEAFGCKGAQVRDPKDLDDAIRQMIDYDGPF
ILDVLVEKHENCFPMIPSGRPHNEMLLGEAETQSVIESQGAVLV
NT seq
1755 nt
NT seq
+upstream
nt +downstream
nt
atgtcccgaacgatgacgggtgcgagaatggtggtcgaagcgctgcgcgatcagggcgtc
gataccgtattcggctatccgggcggggcggtgctacccatctacgacgagatctttcag
cagaacgacatcacccatgtgctggtccgccacgaacagggcgcggtccacatggccgaa
ggctatgcgcgctcgaccggcaagccgggcgtcgttctggtgacgtccggacccggtgcc
acgaacgcggtcaccgggctgaccgacgcgctgctggattcgatcccgctggtcgtgctg
tcgggacaggttccgaccttcctgatcggcaccgacggctttcaggaggcggacacggtc
ggcatcacccgcccctgcaccaagcataactggctggtgaaggacccgggcaagctggcc
gagacgatccacaaggggtttcacgtcgccacatccgggcggcccggcccggtgctgatc
gacattcccaaggatgtgcagttcgcgacggcggaatatgtcggccccaaacaggtcgaa
ccggcccgctatcagccggtgcgcaagggcgatactgccgcgatcacccggctggtcgag
ctgatcgaacaggcggaacggccgatcctgtataccggcggcggcgtcatcaattccggc
cccggcgccagccagcttctgcgcgaactggccgacgccaccggtattcccgtcacctcg
acgctgatggggctgggcgcctatcccgcatcggggcgcaactggatcgggatgctgggg
atgcacggcctgtacgaggccaatctggcgatgcacgactgcgatctgatgatcaatctg
ggcgcgcgcttcgatgaccggatcaccggccgggtcgcggatttcagccccggatcggtc
aaggtccatgtcgatatcgacccgtcctcgatcaacaaggtcatccgggtcgatctgccg
atcatcggcgatgtcggccacgtcctggaagatttgctgaagatctggaaatcgcgcggg
cgcaaggtcaacacggccgcgcttggccaatggtgggaacggatcgagggctggaaatcc
aagaactgcctgttcttccgcaacagcgacaagatcatcaagccgcagcacgcgctgcaa
cggcttgaggcgctgacggcggatcacgaccgctatgtcacgaccgaggtcggtcagcat
cagatgtgggcggcgcagtatctgggcttcgacgagccgaatcgctggatgacgtcgggc
gggctgggaaccatgggctatggtctgccggcgtcgatcggcgtgcagatggcccatccc
gacgcgctggtgatcaacgtggcgggcgatgcaagctggctgatgaacatgcaggaaatg
ggcacggcggtgcagttccgcctgccggtcaagcagttcatcctgaacaacgaaaggctg
ggcatggtgcgccagtggcagcaattgctgcacggcgaacgctatagccagtcgtggtcg
gacagcctgcccgatttcgtcaagctggccgaggcgttcggatgcaagggcgcgcaggtc
cgcgaccccaaggacctggacgacgcgatccggcagatgatcgactatgatggcccgttc
atcctggatgtgctggtcgaaaagcacgagaactgctttccgatgatcccgtccggccgg
ccgcataacgaaatgttgctgggcgaggccgagacgcaaagcgtgatcgaatcgcagggc
gcggttctggtctga
DBGET
integrated database retrieval system