Puccinia striiformis f. sp. tritici (wheat yellow rust fungus): Pst134EA_021375
Help
Entry
Pst134EA_021375 CDS
T09520
Name
(RefSeq) hypothetical protein
KO
K03094
S-phase kinase-associated protein 1
Organism
pstr
Puccinia striiformis f. sp. tritici (wheat yellow rust fungus)
Pathway
pstr03083
Polycomb repressive complex
pstr04111
Cell cycle - yeast
pstr04120
Ubiquitin mediated proteolysis
pstr04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
pstr00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
Pst134EA_021375
04120 Ubiquitin mediated proteolysis
Pst134EA_021375
09126 Chromosome
03083 Polycomb repressive complex
Pst134EA_021375
09140 Cellular Processes
09143 Cell growth and death
04111 Cell cycle - yeast
Pst134EA_021375
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
pstr04131
]
Pst134EA_021375
04121 Ubiquitin system [BR:
pstr04121
]
Pst134EA_021375
03036 Chromosome and associated proteins [BR:
pstr03036
]
Pst134EA_021375
Membrane trafficking [BR:
pstr04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
Pst134EA_021375
Ubiquitin system [BR:
pstr04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
Pst134EA_021375
Cul7 complex
Pst134EA_021375
Chromosome and associated proteins [BR:
pstr03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
Pst134EA_021375
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
Pst134EA_021375
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
72031766
NCBI-ProteinID:
XP_047802707
LinkDB
All DBs
Position
11:3732521..3733596
Genome browser
AA seq
162 aa
AA seq
DB search
MIVDTTDGQEFTVERKVAFQCNLFKGMVECLGPGEEEDEQTMRIPVQVSGPHFKKVLEWC
EYHKDDVAPPPKDADDAPKGPPPISAWDARYIAVDQEMLFDITIAANFLDIPGLLDVCCR
TIGNMIKGKQPDEIRELFNIKNDFTPEEQAQIRMETEWAEDR
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgattgtcgatacaactgatggtcaggagttcaccgtcgaacgaaaagttgcatttcaa
tgtaacctcttcaaggggatggtcgaatgcctcgggcccggggaggaggaggatgagcag
acaatgcgaattccggtgcaggtctctggacctcatttcaaaaaagtacttgaatggtgc
gagtatcataaggatgatgtcgcgccgccgcccaaggacgctgatgatgctcctaaagga
cctcctccgatcagtgcttgggacgccagatatatcgctgttgatcaggagatgctcttc
gatatcacaatagctgcaaactttttggacattccaggtttattggatgtctgctgcagg
acgattggcaacatgatcaagggcaagcaacccgatgagatccgagagctcttcaatatc
aaaaacgactttacccccgaggagcaagctcaaatcagaatggagactgaatgggcagag
gaccgatga
DBGET
integrated database retrieval system