Plautia stali symbiont: E05_01980 Help Entry E05_01980         CDS       T03051                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism psts  Plautia stali symbiont Brite KEGG Orthology (KO) [BR:psts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psts03036]     E05_01980 (ftsL) Chromosome and associated proteins [BR:psts03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     E05_01980 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  BAN94964 UniProt:  U3TR95 LinkDB All DBs Position 179875..180192 Genome browser AA seq 105 aa AA seqDB search MIGNERHSLPGVIGGDLLRFGKIPLLLIAVLVSSVLVVTTTHKTRLLTAQREQLVLERDA LDIEWRNLILEENALGDHSRVERIATDKLQLQHVDPSQENIVVQK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt gtgattggcaatgagcgtcacagcctgcccggcgtcattggtggcgatctgctgcgtttt ggcaagatcccgctgctgctgatcgccgtactggtttcttcggtgctggtggtgaccacc acgcataagacccgtctgctgacggcgcagcgtgagcagctggtgctggagcgtgatgcg ctggatatcgaatggcgcaacctgatcctcgaagagaatgcgctgggcgatcatagccgg gtagaacggatagcaaccgataagctgcagttgcagcatgttgatccttcacaggaaaat attgtggtgcagaaataa

DBGET integrated database retrieval system