Plautia stali symbiont: E05_09590 Help Entry E05_09590         CDS       T03051                                  Name (GenBank) ferritin Dps family protein   KO K04047   starvation-inducible DNA-binding protein Organism psts  Plautia stali symbiont Brite KEGG Orthology (KO) [BR:psts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psts03036]     E05_09590 Chromosome and associated proteins [BR:psts03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     E05_09590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin IQ_SEC7_PH Motif Other DBs NCBI-ProteinID:  BAN95725 UniProt:  U3TPP7 LinkDB All DBs Position complement(769620..769880) Genome browser AA seq 86 aa AA seqDB search MMSTAKLVKTKSSDLIYTRNDVADSEKKATIEVLNRLVVEFIDLSLITKQAHWNMRGANF IGVHEMLDGFRTAITDHQDTIAERVV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgatgagtaccgcaaaactggttaaaacaaaatcttccgatctgatttatacccgcaat gacgtggctgatagcgagaagaaagctaccatcgaggtgctcaaccgtctggtcgtggaa tttattgacctgtcgctgatcaccaagcaggcgcactggaacatgcgcggcgcgaacttc attggcgttcatgaaatgctggatggcttccgcaccgccattaccgatcatcaggacacc attgcagaacgtgtggtatag

DBGET integrated database retrieval system