Plautia stali symbiont: E05_31680 Help Entry E05_31680         CDS       T03051                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism psts  Plautia stali symbiont Brite KEGG Orthology (KO) [BR:psts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psts03110]     E05_31680 Chaperones and folding catalysts [BR:psts03110]  Protein folding catalysts   Protein disulfide isomerase    E05_31680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like GST_N SH3BGR Thioredoxin_3 Thioredoxin_2 DSBA Motif Other DBs NCBI-ProteinID:  BAN97934 UniProt:  U3TZF7 LinkDB All DBs Position 2551969..2552223 Genome browser AA seq 84 aa AA seqDB search MANVEIYTKVTCPYCHRAKALLDQKGVSYQEIPIDGDAVKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDGRQGLDPLLRA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctaatgttgagatttacaccaaagtgacctgtccttactgccaccgggcgaaggcg ttgctggatcaaaaaggtgtgtcataccaggagattcccattgatggggacgcggtaaag cgcgaagagatgatcaaacgcagcggccgcaccacggtgccacagatctttattgacgcg cagcacattggcggctgtgacgatctctacgcgctggacgggcgtcagggactcgatccc ttgctccgcgcataa

DBGET integrated database retrieval system