Plautia stali symbiont: E05_36780 Help Entry E05_36780         CDS       T03051                                  Symbol acpP Name (GenBank) AcpP protein   KO K02078   acyl carrier protein Organism psts  Plautia stali symbiont Pathway psts01100   Metabolic pathways psts01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psts00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E05_36780 (acpP)    00074 Mycolic acid biosynthesis     E05_36780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E05_36780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAN98444 LinkDB All DBs Position complement(2925901..2926137) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIVAEQLGVKEDEVVNGASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINNHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcgtagctgagcagctgggcgttaaagaa gacgaagtggttaacggcgcttctttcgttgaagacctgggtgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgaaattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactatatcaataaccataaaggttaa

DBGET integrated database retrieval system