Plautia stali symbiont: E05_37160 Help Entry E05_37160         CDS       T03051                                  Name (GenBank) dinI family protein   KO K12149   DNA-damage-inducible protein I Organism psts  Plautia stali symbiont Brite KEGG Orthology (KO) [BR:psts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:psts03400]     E05_37160 DNA repair and recombination proteins [BR:psts03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     E05_37160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Kelch_KLHDC2_KLHL20_DRC7 DUF6061 Motif Other DBs NCBI-ProteinID:  BAN98482 UniProt:  U3U547 LinkDB All DBs Position 2953359..2953589 Genome browser AA seq 76 aa AA seqDB search MRVEITVAKTQPLPASALDALSAELTRRISRDFPDDNHHVKVRYAGGNQLSVFGGCKESR DRISDILQETWESADD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaaattaccgtagcaaagactcagccccttcccgccagtgcactggatgca ctgagcgctgaactcactcgccgtatctcccgcgattttcccgacgacaatcatcacgtc aaagtgcgctatgccggtggtaaccagctcagcgtgtttggcggctgtaaagaatcacgc gaccgcatcagcgatattttgcaggaaacctgggaaagcgctgacgactag

DBGET integrated database retrieval system