Plautia stali symbiont: E05_37570 Help Entry E05_37570         CDS       T03051                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psts  Plautia stali symbiont Pathway psts01100   Metabolic pathways psts01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psts00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E05_37570    00074 Mycolic acid biosynthesis     E05_37570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E05_37570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAN98523 UniProt:  U3U2Y6 LinkDB All DBs Position complement(2981009..2981266) Genome browser AA seq 85 aa AA seqDB search MQALIDDIKTMITDTLNLEDISPDDIDSDAPLFGEGVGLDSIDALELGLAVKNRFGVQLS AESETLRAHFFSVATLAAFVEQQQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcactgattgacgacattaaaaccatgattaccgacacgctgaatctggaggat atcagtccggatgatatcgatagcgacgcaccgctgtttggtgaaggggtggggctcgac tcgatcgatgctctggagctggggctggcggtgaaaaaccgcttcggcgtgcagctctcc gccgagagcgaaacgctgcgggcgcactttttttccgtggccacgctggccgcctttgtt gaacaacagcaagcctga

DBGET integrated database retrieval system