KEGG   Plautia stali symbiont: E05_39810
Entry
E05_39810         CDS       T03051                                 
Name
(GenBank) ABC transporter-like protein
  KO
K18893  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
psts  Plautia stali symbiont
Pathway
psts02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psts00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    E05_39810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psts02000]
    E05_39810
Transporters [BR:psts02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    E05_39810
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_22 RsgA_GTPase AAA_16 AAA_29 MMR_HSR1 AAA_21 AAA AAA_30 DUF87 MeaB AAA_18 AAA_5 P-loop_TraG AAA_33 AAA_28 AAA_10 nSTAND1
Other DBs
NCBI-ProteinID: BAN98747
LinkDB
Position
3154202..3155242
AA seq 346 aa
MVTSMDITLSTLNGLLIVSTSGLALWLWSQSLISMGAITLATGLVIRQVNMSGWIMWVVN
GIFENIGMVQDGLNTIAQPLSVQDAPQAKKLQVTRGQIRFEDVRFDYGGGRQVINRLNLN
IKPSEKIGLIGPSGAGKSTLVNLLLRLYDINGGRILIDDQDIAQVTQASLRSQIGMITQD
TSLLHRSIRENLLYGRPDASEAELQAAIVRARADEFIPLLSDPQGRTGLDAHVGERGVKL
SGGQRQRIAIAHVLLKDAPVLIMDEATSALDSEVEAAIQESLETLMQGKTVIAIAHRLST
IAKMDRLVVLENGDIVEMGNHRELLAHGGLYARLWQHQTGGFVGVD
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggtgaccagcatggatatcacgctgtcgacgctcaatggcctgctgattgtcagcacc
tccggcctcgcgctgtggctgtggagccagtcgctgatcagcatgggcgccatcacgctg
gccaccgggctggtgattcgccaggtgaacatgtccggctggatcatgtgggtggtgaac
ggcatcttcgaaaacatcggcatggtgcaggatggcctgaacaccattgcgcaaccgctc
agcgtgcaggatgcgccgcaggcgaaaaagctgcaggtgacgcgcggccagatccgcttt
gaggatgtgcgttttgactacggcggcggccgccaggtgattaaccgcctgaatctcaac
atcaagcctagcgagaaaatcggtctgattggcccgtccggcgctggtaaatcgaccctc
gtgaacctgctgctgcggctgtatgacatcaacggcgggcgcattctgattgacgatcag
gacatcgcgcaggtcacgcaggcgagcctgcgcagtcagattgggatgatcacccaagat
acatcgctgctgcaccgctcgattcgcgaaaacctgctgtacggtcgcccggatgccagc
gaagccgaactgcaggcggcgattgtgcgcgcccgcgccgacgagtttatcccactgctc
tctgatccgcagggccgtaccgggctggatgcgcacgtcggcgagcgcggcgtcaaactc
tctggcggccagcgccagcgtattgccatcgcccacgtgctgctgaaagatgcgccggtt
ctgatcatggatgaagccacgtcggcgctcgactcggaagtggaagcggcgattcaggag
agcctggagacgctgatgcagggcaaaacggtgatcgccatcgcccatcgcctgtcgacc
attgcaaaaatggaccggctggtggtgctggagaacggcgacattgttgagatgggtaac
catcgcgaactgctggcgcacggcgggctgtacgcgcgcctgtggcagcatcagaccggc
ggatttgtcggcgtcgattaa

DBGET integrated database retrieval system