Plautia stali symbiont: E05_45390 Help Entry E05_45390         CDS       T03051                                  Name (GenBank) hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism psts  Plautia stali symbiont Brite KEGG Orthology (KO) [BR:psts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:psts03400]     E05_45390 DNA repair and recombination proteins [BR:psts03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     E05_45390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RseA_C Motif Other DBs NCBI-ProteinID:  BAN99305 UniProt:  U3TZL8 LinkDB All DBs Position 3580824..3581057 Genome browser AA seq 77 aa AA seqDB search MRIEIMLVKNQKTSQSVVDAFREEVDKRVIALFPNAVVQVRQGSYNKIEMPGVEVDEDRR RLNDLLQNVWADDSWLH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt ttgcgtattgaaatcatgctcgtcaagaatcagaaaaccagtcagtcggtggtagatgct ttccgggaagaagtagataaacgagtgattgcgctgtttcctaatgcagtggtacaggtg cggcagggcagttacaacaaaatcgaaatgcccggtgtggaagttgatgaagaccggcgc aggctaaatgatttacttcagaacgtctgggcagatgacagctggctgcattga

DBGET integrated database retrieval system