Stutzerimonas stutzeri 28a24: CH92_02625 Help Entry CH92_02625        CDS       T03390                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pstt  Stutzerimonas stutzeri 28a24 Pathway pstt01100   Metabolic pathways pstt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pstt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CH92_02625    00074 Mycolic acid biosynthesis     CH92_02625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CH92_02625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GRIN_C M2AP_beta_dom Motif Other DBs NCBI-ProteinID:  AHL74054 UniProt:  W8QUX0 LinkDB All DBs Position complement(551002..551265) Genome browser AA seq 87 aa AA seqDB search MSQLQLEIKQLIIDALGLEDLGPNDIAADQPLFGEGLGLDSVDALELGLAIQKHFGIKID ADAKDTRKHFASVDSLAAYVSANRAIA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccaactgcagcttgaaatcaagcaactgatcatcgacgccctgggtctggaagac ctcggcccgaatgacatcgcggccgatcagccgctcttcggcgaagggctcgggctggac tcggtcgacgccctggaattgggcctggcgattcagaagcacttcggcatcaagatcgat gccgacgccaaggacactcgcaagcatttcgccagtgttgacagcctggccgcctacgtt agcgccaatcgcgccatcgcctga

DBGET integrated database retrieval system