Stutzerimonas stutzeri 28a24: CH92_03750 Help Entry CH92_03750        CDS       T03390                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism pstt  Stutzerimonas stutzeri 28a24 Pathway pstt00260   Glycine, serine and threonine metabolism pstt01100   Metabolic pathways Module pstt_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:pstt00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     CH92_03750 Enzymes [BR:pstt01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      CH92_03750     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      CH92_03750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  AHL74246 UniProt:  W8RQD0 LinkDB All DBs Position complement(777799..778125) Genome browser AA seq 108 aa AA seqDB search MLHIFCPHCGELRSEEEFHAGGQAHIPRPLDPNACTDEEWGEYLFFRDNPRGIHHELWIH ASGCRQYFNVTRHTVSYEILETYKIGEQPSVTEASLTAKKAVDQGVTA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgctgcacatcttctgccctcactgtggcgaactgcgttccgaagaagaattccacgcc ggcggccaggcgcacattccgcgtccgctggacccgaacgcctgcaccgacgaggagtgg ggcgagtacctgttctttcgcgacaacccgcgcggcattcaccatgagctgtggattcac gcatcgggctgccgccagtacttcaatgtcacccgccacacggtgagctacgaaattctc gaaacctacaagatcggcgagcagcccagcgtgactgaggcttcgctcactgcgaagaag gctgtcgaccaaggagtaacggcatga

DBGET integrated database retrieval system