Stutzerimonas stutzeri 28a24: CH92_18030 Help Entry CH92_18030        CDS       T03390                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism pstt  Stutzerimonas stutzeri 28a24 Pathway pstt02024   Quorum sensing pstt03018   RNA degradation Brite KEGG Orthology (KO) [BR:pstt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CH92_18030  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CH92_18030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pstt03019]     CH92_18030    03036 Chromosome and associated proteins [BR:pstt03036]     CH92_18030 Messenger RNA biogenesis [BR:pstt03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CH92_18030 Chromosome and associated proteins [BR:pstt03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CH92_18030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AHL76877 UniProt:  W8REF2 LinkDB All DBs Position complement(3881476..3881730) Genome browser AA seq 84 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPGRPVRLPAAGDAEQSESGND NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaacactttgcgtaaggaacgcgtt ccggtttccatctacttggtcaacggtatcaagctccagggtcagatcgagtcattcgac caattcgtcatcctcttgaagaatactgtcagtcagatggtatacaagcatgctatttcg accgttgttcccggccgtccggtgcgtctgccggcagctggcgatgcggagcagtccgag tcgggtaacgactaa

DBGET integrated database retrieval system