Stutzerimonas decontaminans: UIB01_07935 Help Entry UIB01_07935       CDS       T03366                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pstu  Stutzerimonas decontaminans Pathway pstu01100   Metabolic pathways pstu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pstu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UIB01_07935    00074 Mycolic acid biosynthesis     UIB01_07935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UIB01_07935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AHY42418 UniProt:  W8QW51 LinkDB All DBs Position 1667690..1667926 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttcctttgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaggct gagaagatcaccaccgttcaggaagccatcgattacatcaatgcgcatgcgcagtaa

DBGET integrated database retrieval system