Stutzerimonas decontaminans: UIB01_18665 Help Entry UIB01_18665       CDS       T03366                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pstu  Stutzerimonas decontaminans Pathway pstu01100   Metabolic pathways pstu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pstu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UIB01_18665    00074 Mycolic acid biosynthesis     UIB01_18665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UIB01_18665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHY44379 UniProt:  A0A023WX22 LinkDB All DBs Position 3934190..3934456 Genome browser AA seq 88 aa AA seqDB search MSQQLQREIKQLIIDALGLEDLGPDDIVADQPLFGEGLGLDSVDALELGLAIQKRFGIKI DADAKDTRKHFASVDSLAAFVSASRAIA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagccaacaattacaacgtgaaatcaaacaactgatcatcgacgctctgggtcttgaa gaccttggtccggatgacatcgtcgccgaccagccattgttcggcgaaggccttggcctc gactcggtggacgccctggaactaggtctggcgatccagaagcgcttcggcatcaagatc gacgccgacgccaaggacacccgcaagcatttcgccagcgtcgacagcctggcagccttc gtcagcgccagccgcgccatcgcctga

DBGET integrated database retrieval system