Pantoea stewartii subsp. stewartii: DSJ_08350 Help Entry DSJ_08350         CDS       T04970                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism pstw  Pantoea stewartii subsp. stewartii Pathway pstw00190   Oxidative phosphorylation pstw01100   Metabolic pathways pstw02020   Two-component system Module pstw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:pstw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DSJ_08350  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DSJ_08350 Enzymes [BR:pstw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DSJ_08350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ARF49344 UniProt:  H3RAT2 LinkDB All DBs Position 1727177..1727290 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALAIEHIEDSADAERQS NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattctcggcaccctgctggcctgtgcctttggcatcatcacc gcgctggcgatagaacatatcgaagacagcgccgacgcggaacgccagtcgtaa

DBGET integrated database retrieval system