Pantoea stewartii subsp. stewartii: DSJ_10670 Help Entry DSJ_10670         CDS       T04970                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pstw  Pantoea stewartii subsp. stewartii Pathway pstw01100   Metabolic pathways pstw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pstw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSJ_10670    00074 Mycolic acid biosynthesis     DSJ_10670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSJ_10670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ARF49758 LinkDB All DBs Position 2163749..2163985 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtgaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgaaattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactatatcaatagccacaaaggctaa

DBGET integrated database retrieval system