Pantoea stewartii subsp. stewartii: DSJ_11250
Help
Entry
DSJ_11250 CDS
T04970
Name
(GenBank) muramoyltetrapeptide carboxypeptidase
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
pstw
Pantoea stewartii subsp. stewartii
Brite
KEGG Orthology (KO) [BR:
pstw00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
pstw01002
]
DSJ_11250
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
pstw01011
]
DSJ_11250
Enzymes [BR:
pstw01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
DSJ_11250
Peptidases and inhibitors [BR:
pstw01002
]
Serine peptidases
Family S66
DSJ_11250
Peptidoglycan biosynthesis and degradation proteins [BR:
pstw01011
]
Precursor biosynthesis
Carboxypeptidase
DSJ_11250
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
ARF49865
UniProt:
H3RE52
LinkDB
All DBs
Position
complement(2259393..2260316)
Genome browser
AA seq
307 aa
AA seq
DB search
MTSRSIRLIAPSGYCHNQPAAHLGVERLRAAGHQVENTGAIARRFQRFAGTDSERLDDIN
ALADLATLPDIVLAVRGGYGATRLLPSINYAALQRRLADQPLALCGHSDFTVIQLALLQH
AGIISFSGPMLAGNFGAAVLSEFTLQHFWQALTSPTVSVNWKSDTPDNGTWHGTLWGGNL
AMISSLIGTPWMPAITDGILVIEDVNEHPFRIERMLLQLHQCGILAQQRAIITGSFTSTA
LSDYDNGFDFATVWQYLRDLSGLPVISDLDFGHGPDTVTLPLGARATLAVHQGQVSLQAS
GHPVLRT
NT seq
924 nt
NT seq
+upstream
nt +downstream
nt
atgacgtcacgttcaatccgtcttatcgccccttcaggttattgccacaatcagcctgca
gcccatctgggggttgaacgcctgcgcgcagcggggcaccaggttgaaaatacgggggca
atcgcacggcgttttcaacgttttgccggtacggattcggaacgcttagacgatatcaat
gcgctggccgatctggcgaccttacctgatattgtgctggcagtgcgcggcggctacggt
gccacgcgcctgctgccctcaatcaactatgccgcgttacagcgccgcttagcggaccag
ccgctggcactgtgtggccacagcgacttcaccgtgattcaactggccttactgcaacac
gccggaataatcagcttcagtgggccgatgctggcgggcaactttggcgctgcggtttta
tccgaatttaccctgcagcacttttggcaggcgctgacatcacctacagtcagtgtgaac
tggaaaagtgacacgcccgataacggtacctggcacggtacgttatggggaggaaacctg
gcgatgatcagctcgcttatcggtacgccgtggatgccggccatcacagacggcattctg
gtgattgaggatgtgaatgagcatccgttccggattgaacgtatgctgctgcagctccac
cagtgtgggattctggcgcagcaacgggcgattatcaccggcagtttcaccagcaccgcc
ttgtccgactacgataacgggtttgacttcgccacggtctggcagtacctccgcgatctg
agcggtctgcccgttatcagcgatctggatttcggtcacggccctgacaccgtgaccctg
ccgttgggtgccagggcgaccttagcggtacatcagggacaggtcagtttacaggcaagc
gggcatcccgtattgcgcacataa
DBGET
integrated database retrieval system